PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00155.1.g00270.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27930 Da    PI: 9.9691
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00155.1.g00270.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.53.1e-274291251
                                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    rie+++ rqvtfskRr g+lKKA+ELSvLCdaev +i+fs++g+ly ++s
  Zjn_sc00155.1.g00270.1.sm.mkhc 42 RIEDTTSRQVTFSKRRSGLLKKAFELSVLCDAEVGLIVFSPRGRLYQFAS 91
                                    8***********************************************86 PP

2K-box24.89.3e-101221651557
                           K-box  15 eslqqelakLkkeienLqreqR.hllGedLesLslkeLqqLeqq 57 
                                     e+++ e++ L+k+i++ +  +R +llGe+L+s+s++eLq+Le++
  Zjn_sc00155.1.g00270.1.sm.mkhc 122 ERWKWEATTLEKKIDEVEAHKRwKLLGEGLGSCSIQELQELEER 165
                                     789***************666659*****************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.7E-353392IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.8753393IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-283555IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-2835114IPR002100Transcription factor, MADS-box
PfamPF003197.2E-264289IPR002100Transcription factor, MADS-box
CDDcd002655.19E-3443108No hitNo description
PRINTSPR004046.5E-285570IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-287091IPR002100Transcription factor, MADS-box
PfamPF014865.0E-8122164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVATAAMAAE AAPSPEGGDQ IVAEAPDGRK KLGRRGRREM RRIEDTTSRQ VTFSKRRSGL  60
LKKAFELSVL CDAEVGLIVF SPRGRLYQFA SAIELQKTID RYLNHTKGTN VNLKVDDLPG  120
IERWKWEATT LEKKIDEVEA HKRWKLLGEG LGSCSIQELQ ELEERNLWKE NEMLRDQSSA  180
ERGRERERGR ERNHIRLLSI LLHRVGPERS AYYFSLLLSP VVSFWDCIFR KIRYSFRPEW  240
V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-1728123290Myocyte-specific enhancer factor 2B
1tqe_Q6e-1728123290Myocyte-specific enhancer factor 2B
1tqe_R6e-1728123290Myocyte-specific enhancer factor 2B
1tqe_S6e-1728123290Myocyte-specific enhancer factor 2B
3kov_A6e-1728102168Myocyte-specific enhancer factor 2A
3kov_B6e-1728102168Myocyte-specific enhancer factor 2A
3kov_I6e-1728102168Myocyte-specific enhancer factor 2A
3kov_J6e-1728102168Myocyte-specific enhancer factor 2A
3p57_A6e-1728102168Myocyte-specific enhancer factor 2A
3p57_B6e-1728102168Myocyte-specific enhancer factor 2A
3p57_C6e-1728102168Myocyte-specific enhancer factor 2A
3p57_D6e-1728102168Myocyte-specific enhancer factor 2A
3p57_I6e-1728102168Myocyte-specific enhancer factor 2A
3p57_J6e-1728102168Myocyte-specific enhancer factor 2A
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181191RGRERERGRER
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0985092e-71FP098509.1 Phyllostachys edulis cDNA clone: bphylf003i12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451346.15e-59hypothetical protein SORBIDRAFT_04g000500
SwissprotO646452e-49SOC1_ARATH; MADS-box protein SOC1
TrEMBLC5XRI85e-59C5XRI8_SORBI; Putative uncharacterized protein Sb04g000500
STRINGSb04g000500.11e-58(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-46AGAMOUS-like 20